STYK1 monoclonal antibody (M04), clone 4A2
  • STYK1 monoclonal antibody (M04), clone 4A2

STYK1 monoclonal antibody (M04), clone 4A2

Ref: AB-H00055359-M04
STYK1 monoclonal antibody (M04), clone 4A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STYK1.
Información adicional
Size 100 ug
Gene Name STYK1
Gene Alias DKFZp761P1010|NOK|SuRTK106
Gene Description serine/threonine/tyrosine kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STYK1 (NP_060893, 50 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55359
Clone Number 4A2
Iso type IgG1 Kappa

Enviar uma mensagem


STYK1 monoclonal antibody (M04), clone 4A2

STYK1 monoclonal antibody (M04), clone 4A2