STK32B polyclonal antibody (A01)
  • STK32B polyclonal antibody (A01)

STK32B polyclonal antibody (A01)

Ref: AB-H00055351-A01
STK32B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STK32B.
Información adicional
Size 50 uL
Gene Name STK32B
Gene Alias HSA250839|STK32|STKG6|YANK2
Gene Description serine/threonine kinase 32B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELEEMILESKPLHKKKKRLAKNRSRDGTKDSCPLNGHLQHCLETVREEFIIFNREKLRRQQGQGSQLLDTDSRGGGQAQSKLQDGCNNNLLTHTCTRGCSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STK32B (AAH38238, 314 a.a. ~ 414 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55351

Enviar uma mensagem


STK32B polyclonal antibody (A01)

STK32B polyclonal antibody (A01)