VNN3 monoclonal antibody (M01), clone 3E1
  • VNN3 monoclonal antibody (M01), clone 3E1

VNN3 monoclonal antibody (M01), clone 3E1

Ref: AB-H00055350-M01
VNN3 monoclonal antibody (M01), clone 3E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VNN3.
Información adicional
Size 100 ug
Gene Name VNN3
Gene Alias HSA238982|MGC171203|PAGEL-beta|PAGEL-eta|PAGEL-zeta
Gene Description vanin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VNN3 (NP_060869.2, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55350
Clone Number 3E1
Iso type IgG2b Kappa

Enviar uma mensagem


VNN3 monoclonal antibody (M01), clone 3E1

VNN3 monoclonal antibody (M01), clone 3E1