CHDH purified MaxPab rabbit polyclonal antibody (D01P)
  • CHDH purified MaxPab rabbit polyclonal antibody (D01P)

CHDH purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055349-D01P
CHDH purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CHDH protein.
Información adicional
Size 100 ug
Gene Name CHDH
Gene Alias -
Gene Description choline dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MWCLLRGLGRPGALARGALGQQQSLGARALASAGSESRDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPKDVRAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVLYWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGARGWDYAHCLPYFRKAQGHELGASRYRGADGPLRVSRGKTNHPLHCAFLEATQQAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSAACAYLHPALSRTNLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHDH (NP_060867.1, 1 a.a. ~ 594 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55349

Enviar uma mensagem


CHDH purified MaxPab rabbit polyclonal antibody (D01P)

CHDH purified MaxPab rabbit polyclonal antibody (D01P)