GIMAP5 monoclonal antibody (M10), clone 1E10
  • GIMAP5 monoclonal antibody (M10), clone 1E10

GIMAP5 monoclonal antibody (M10), clone 1E10

Ref: AB-H00055340-M10
GIMAP5 monoclonal antibody (M10), clone 1E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GIMAP5.
Información adicional
Size 100 ug
Gene Name GIMAP5
Gene Alias FLJ11296|HIMAP3|IAN4|IAN4L1|IAN5|IMAP3|hIAN5
Gene Description GTPase, IMAP family member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq AFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLMLLHYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GIMAP5 (NP_060854.2, 186 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55340
Clone Number 1E10
Iso type IgG2a Kappa

Enviar uma mensagem


GIMAP5 monoclonal antibody (M10), clone 1E10

GIMAP5 monoclonal antibody (M10), clone 1E10