FBXL8 purified MaxPab mouse polyclonal antibody (B01P)
  • FBXL8 purified MaxPab mouse polyclonal antibody (B01P)

FBXL8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055336-B01P
FBXL8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FBXL8 protein.
Información adicional
Size 50 ug
Gene Name FBXL8
Gene Alias FBL8|FLJ11278|MGC19959
Gene Description F-box and leucine-rich repeat protein 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXL8 (NP_060848.2, 1 a.a. ~ 374 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55336

Enviar uma mensagem


FBXL8 purified MaxPab mouse polyclonal antibody (B01P)

FBXL8 purified MaxPab mouse polyclonal antibody (B01P)