C10orf59 purified MaxPab rabbit polyclonal antibody (D01P)
  • C10orf59 purified MaxPab rabbit polyclonal antibody (D01P)

C10orf59 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055328-D01P
C10orf59 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C10orf59 protein.
Información adicional
Size 100 ug
Gene Name C10orf59
Gene Alias FLJ11218|RENALASE
Gene Description chromosome 10 open reading frame 59
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C10orf59 (NP_001026879.1, 1 a.a. ~ 342 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55328

Enviar uma mensagem


C10orf59 purified MaxPab rabbit polyclonal antibody (D01P)

C10orf59 purified MaxPab rabbit polyclonal antibody (D01P)