RNF121 polyclonal antibody (A01)
  • RNF121 polyclonal antibody (A01)

RNF121 polyclonal antibody (A01)

Ref: AB-H00055298-A01
RNF121 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF121.
Información adicional
Size 50 uL
Gene Name RNF121
Gene Alias FLJ11099
Gene Description ring finger protein 121
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ERDFAEMCADYMASTIGFYSESGMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMFSNPWERPHVMYGQLLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF121 (NP_060790.2, 193 a.a. ~ 301 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55298

Enviar uma mensagem


RNF121 polyclonal antibody (A01)

RNF121 polyclonal antibody (A01)