FBXW7 purified MaxPab rabbit polyclonal antibody (D01P)
  • FBXW7 purified MaxPab rabbit polyclonal antibody (D01P)

FBXW7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055294-D01P
FBXW7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FBXW7 protein.
Información adicional
Size 100 ug
Gene Name FBXW7
Gene Alias AGO|CDC4|DKFZp686F23254|FBW6|FBW7|FBX30|FBXO30|FBXW6|FLJ16457|SEL-10|SEL10
Gene Description F-box and WD repeat domain containing 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRTHGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXW7 (NP_060785.2, 1 a.a. ~ 627 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55294

Enviar uma mensagem


FBXW7 purified MaxPab rabbit polyclonal antibody (D01P)

FBXW7 purified MaxPab rabbit polyclonal antibody (D01P)