UEVLD purified MaxPab mouse polyclonal antibody (B01P)
  • UEVLD purified MaxPab mouse polyclonal antibody (B01P)

UEVLD purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055293-B01P
UEVLD purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UEVLD protein.
Información adicional
Size 50 ug
Gene Name UEVLD
Gene Alias ATTP|FLJ11068|UEV3
Gene Description UEV and lactate/malate dehyrogenase domains
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UEVLD (AAH64566.1, 1 a.a. ~ 357 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55293

Enviar uma mensagem


UEVLD purified MaxPab mouse polyclonal antibody (B01P)

UEVLD purified MaxPab mouse polyclonal antibody (B01P)