RHOT1 monoclonal antibody (M01), clone 4H4
  • RHOT1 monoclonal antibody (M01), clone 4H4

RHOT1 monoclonal antibody (M01), clone 4H4

Ref: AB-H00055288-M01
RHOT1 monoclonal antibody (M01), clone 4H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RHOT1.
Información adicional
Size 100 ug
Gene Name RHOT1
Gene Alias ARHT1|FLJ11040|FLJ12633|MIRO-1
Gene Description ras homolog gene family, member T1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55288
Clone Number 4H4
Iso type IgG1 Kappa

Enviar uma mensagem


RHOT1 monoclonal antibody (M01), clone 4H4

RHOT1 monoclonal antibody (M01), clone 4H4