RHOT1 polyclonal antibody (A01)
  • RHOT1 polyclonal antibody (A01)

RHOT1 polyclonal antibody (A01)

Ref: AB-H00055288-A01
RHOT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RHOT1.
Información adicional
Size 50 uL
Gene Name RHOT1
Gene Alias ARHT1|FLJ11040|FLJ12633|MIRO-1
Gene Description ras homolog gene family, member T1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55288

Enviar uma mensagem


RHOT1 polyclonal antibody (A01)

RHOT1 polyclonal antibody (A01)