FLJ10986 monoclonal antibody (M04), clone 3B9
  • FLJ10986 monoclonal antibody (M04), clone 3B9

FLJ10986 monoclonal antibody (M04), clone 3B9

Ref: AB-H00055277-M04
FLJ10986 monoclonal antibody (M04), clone 3B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FLJ10986.
Información adicional
Size 100 ug
Gene Name FGGY
Gene Alias FLJ10986
Gene Description FGGY carbohydrate kinase domain containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLJ10986 (NP_060761, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55277
Clone Number 3B9
Iso type IgG2b Kappa

Enviar uma mensagem


FLJ10986 monoclonal antibody (M04), clone 3B9

FLJ10986 monoclonal antibody (M04), clone 3B9