FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)
  • FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)

FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055277-B01P
FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FLJ10986 protein.
Información adicional
Size 50 ug
Gene Name FGGY
Gene Alias FLJ10986
Gene Description FGGY carbohydrate kinase domain containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FLJ10986 (NP_060761.2, 1 a.a. ~ 439 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55277

Enviar uma mensagem


FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)

FLJ10986 purified MaxPab mouse polyclonal antibody (B01P)