PGM2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PGM2 purified MaxPab rabbit polyclonal antibody (D01P)

PGM2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055276-D01P
PGM2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PGM2 protein.
Información adicional
Size 100 ug
Gene Name PGM2
Gene Alias FLJ10983|MSTP006
Gene Description phosphoglucomutase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSDITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVHTSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PGM2 (NP_060760.2, 1 a.a. ~ 612 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55276

Enviar uma mensagem


PGM2 purified MaxPab rabbit polyclonal antibody (D01P)

PGM2 purified MaxPab rabbit polyclonal antibody (D01P)