PANK4 monoclonal antibody (M10), clone 3C1
  • PANK4 monoclonal antibody (M10), clone 3C1

PANK4 monoclonal antibody (M10), clone 3C1

Ref: AB-H00055229-M10
PANK4 monoclonal antibody (M10), clone 3C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PANK4.
Información adicional
Size 100 ug
Gene Name PANK4
Gene Alias DKFZp547M242|FLJ10782
Gene Description pantothenate kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq AGMDPVVHSALQEERLLLVQTGSSSPCLDLSRLDKGLAALVRERGADLVVIEGMGRAVHTNYHAALRCESLKLAVIKNAWLAERLGGRLFSVIFKYEVPAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PANK4 (NP_060686.1, 673 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55229
Clone Number 3C1
Iso type IgG2a Kappa

Enviar uma mensagem


PANK4 monoclonal antibody (M10), clone 3C1

PANK4 monoclonal antibody (M10), clone 3C1