LRRC20 purified MaxPab mouse polyclonal antibody (B01P)
  • LRRC20 purified MaxPab mouse polyclonal antibody (B01P)

LRRC20 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055222-B01P
LRRC20 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LRRC20 protein.
Información adicional
Size 50 ug
Gene Name LRRC20
Gene Alias FLJ10751|FLJ10844
Gene Description leucine rich repeat containing 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LRRC20 (NP_997002.1, 1 a.a. ~ 184 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55222

Enviar uma mensagem


LRRC20 purified MaxPab mouse polyclonal antibody (B01P)

LRRC20 purified MaxPab mouse polyclonal antibody (B01P)