EXDL2 purified MaxPab mouse polyclonal antibody (B01P)
  • EXDL2 purified MaxPab mouse polyclonal antibody (B01P)

EXDL2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055218-B01P
EXDL2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EXDL2 protein.
Información adicional
Size 50 ug
Gene Name EXDL2
Gene Alias C14orf114|DKFZp781A0133|DKFZp781L15100|FLJ10738
Gene Description exonuclease 3'-5' domain-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MASPSGLCVLVRLPKLICGGKTLPRTLLDILADGTILKVGVGCSEDASKLLQDYGLVVRGCLDLRYLAMRQRNNLLCNGLSLKSLAETVLNFPLDKSLLLRCSNWDAETLTEDQVIYAARDAQISVALFLHLLGYPFSRNSPGEKNDDHSSWRKVLEKCQGVVDIPFRSKGMSRLGEEVNGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARKSPLYDNCFLHAPDGQPLCTCDRRKAQWYL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EXDL2 (NP_060669.1, 1 a.a. ~ 496 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55218

Enviar uma mensagem


EXDL2 purified MaxPab mouse polyclonal antibody (B01P)

EXDL2 purified MaxPab mouse polyclonal antibody (B01P)