MAP1S monoclonal antibody (M05), clone 4H2
  • MAP1S monoclonal antibody (M05), clone 4H2

MAP1S monoclonal antibody (M05), clone 4H2

Ref: AB-H00055201-M05
MAP1S monoclonal antibody (M05), clone 4H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP1S.
Información adicional
Size 100 ug
Gene Name MAP1S
Gene Alias BPY2IP1|C19orf5|FLJ10669|MAP8|MGC133087|VCY2IP-1|VCY2IP1
Gene Description microtubule-associated protein 1S
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP1S (NP_060644.4, 929 a.a. ~ 1026 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55201
Clone Number 4H2
Iso type IgG2a Kappa

Enviar uma mensagem


MAP1S monoclonal antibody (M05), clone 4H2

MAP1S monoclonal antibody (M05), clone 4H2