PBRM1 purified MaxPab mouse polyclonal antibody (B02P)
  • PBRM1 purified MaxPab mouse polyclonal antibody (B02P)

PBRM1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00055193-B02P
PBRM1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PBRM1 protein.
Información adicional
Size 50 ug
Gene Name PBRM1
Gene Alias BAF180|MGC156155|MGC156156|PB1
Gene Description polybromo 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEGMMGGYPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPYGQQVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PBRM1 (AAH15323.1, 1 a.a. ~ 306 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55193

Enviar uma mensagem


PBRM1 purified MaxPab mouse polyclonal antibody (B02P)

PBRM1 purified MaxPab mouse polyclonal antibody (B02P)