MRPS10 purified MaxPab mouse polyclonal antibody (B02P)
  • MRPS10 purified MaxPab mouse polyclonal antibody (B02P)

MRPS10 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00055173-B02P
MRPS10 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MRPS10 protein.
Información adicional
Size 50 ug
Gene Name MRPS10
Gene Alias FLJ10567|MRP-S10|PNAS-122
Gene Description mitochondrial ribosomal protein S10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEEKEESKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPS10 (NP_060611.2, 1 a.a. ~ 201 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55173

Enviar uma mensagem


MRPS10 purified MaxPab mouse polyclonal antibody (B02P)

MRPS10 purified MaxPab mouse polyclonal antibody (B02P)