PRMT6 monoclonal antibody (M02), clone 3C3
  • PRMT6 monoclonal antibody (M02), clone 3C3

PRMT6 monoclonal antibody (M02), clone 3C3

Ref: AB-H00055170-M02
PRMT6 monoclonal antibody (M02), clone 3C3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PRMT6.
Información adicional
Size 100 ug
Gene Name PRMT6
Gene Alias FLJ10559|HRMT1L6
Gene Description protein arginine methyltransferase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRMT6 (NP_060607.1, 1 a.a. ~ 316 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55170
Clone Number 3C3
Iso type IgG2a Kappa

Enviar uma mensagem


PRMT6 monoclonal antibody (M02), clone 3C3

PRMT6 monoclonal antibody (M02), clone 3C3