PNPO purified MaxPab mouse polyclonal antibody (B01P)
  • PNPO purified MaxPab mouse polyclonal antibody (B01P)

PNPO purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055163-B01P
PNPO purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PNPO protein.
Información adicional
Size 50 ug
Gene Name PNPO
Gene Alias FLJ10535|PDXPO
Gene Description pyridoxamine 5'-phosphate oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PNPO (NP_060599.1, 1 a.a. ~ 261 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55163

Enviar uma mensagem


PNPO purified MaxPab mouse polyclonal antibody (B01P)

PNPO purified MaxPab mouse polyclonal antibody (B01P)