PNPO polyclonal antibody (A01)
  • PNPO polyclonal antibody (A01)

PNPO polyclonal antibody (A01)

Ref: AB-H00055163-A01
PNPO polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PNPO.
Información adicional
Size 50 uL
Gene Name PNPO
Gene Alias FLJ10535|PDXPO
Gene Description pyridoxamine 5'-phosphate oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PNPO (NP_060599, 163 a.a. ~ 261 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55163

Enviar uma mensagem


PNPO polyclonal antibody (A01)

PNPO polyclonal antibody (A01)