ARMC1 purified MaxPab mouse polyclonal antibody (B01P)
  • ARMC1 purified MaxPab mouse polyclonal antibody (B01P)

ARMC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055156-B01P
ARMC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARMC1 protein.
Información adicional
Size 50 ug
Gene Name ARMC1
Gene Alias Arcp|FLJ10511
Gene Description armadillo repeat containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MNSSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTELPDYLPEDESPTKEQDKAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARMC1 (NP_060590.1, 1 a.a. ~ 282 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55156

Enviar uma mensagem


ARMC1 purified MaxPab mouse polyclonal antibody (B01P)

ARMC1 purified MaxPab mouse polyclonal antibody (B01P)