THAP1 monoclonal antibody (M01), clone 2C1-2F2
  • THAP1 monoclonal antibody (M01), clone 2C1-2F2

THAP1 monoclonal antibody (M01), clone 2C1-2F2

Ref: AB-H00055145-M01
THAP1 monoclonal antibody (M01), clone 2C1-2F2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant THAP1.
Información adicional
Size 100 ug
Gene Name THAP1
Gene Alias FLJ10477|MGC33014
Gene Description THAP domain containing, apoptosis associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen THAP1 (AAH21721, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55145
Clone Number 2C1-2F2
Iso type IgG2b Kappa

Enviar uma mensagem


THAP1 monoclonal antibody (M01), clone 2C1-2F2

THAP1 monoclonal antibody (M01), clone 2C1-2F2