THAP1 MaxPab rabbit polyclonal antibody (D01)
  • THAP1 MaxPab rabbit polyclonal antibody (D01)

THAP1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00055145-D01
THAP1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human THAP1 protein.
Información adicional
Size 100 uL
Gene Name THAP1
Gene Alias FLJ10477|MGC33014
Gene Description THAP domain containing, apoptosis associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen THAP1 (NP_060575.1, 1 a.a. ~ 213 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 55145

Enviar uma mensagem


THAP1 MaxPab rabbit polyclonal antibody (D01)

THAP1 MaxPab rabbit polyclonal antibody (D01)