THAP1 purified MaxPab mouse polyclonal antibody (B01P)
  • THAP1 purified MaxPab mouse polyclonal antibody (B01P)

THAP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055145-B01P
THAP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human THAP1 protein.
Información adicional
Size 50 ug
Gene Name THAP1
Gene Alias FLJ10477|MGC33014
Gene Description THAP domain containing, apoptosis associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen THAP1 (NP_060575.1, 1 a.a. ~ 213 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55145

Enviar uma mensagem


THAP1 purified MaxPab mouse polyclonal antibody (B01P)

THAP1 purified MaxPab mouse polyclonal antibody (B01P)