Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
WDR79 monoclonal antibody (M04), clone 1F12
Abnova
WDR79 monoclonal antibody (M04), clone 1F12
Ref: AB-H00055135-M04
WDR79 monoclonal antibody (M04), clone 1F12
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant WDR79.
Información adicional
Size
100 ug
Gene Name
WDR79
Gene Alias
FLJ10385|WRAP53
Gene Description
WD repeat domain 79
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq
AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
WDR79 (NP_060551.1, 62 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
55135
Clone Number
1F12
Iso type
IgG2a Kappa
Enviar uma mensagem
WDR79 monoclonal antibody (M04), clone 1F12
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*