ARMC4 monoclonal antibody (M02A), clone 5F1
  • ARMC4 monoclonal antibody (M02A), clone 5F1

ARMC4 monoclonal antibody (M02A), clone 5F1

Ref: AB-H00055130-M02A
ARMC4 monoclonal antibody (M02A), clone 5F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARMC4.
Información adicional
Size 200 uL
Gene Name ARMC4
Gene Alias DKFZp434P1735|FLJ10376|FLJ10817|FLJ32798|RP11-691I13.1
Gene Description armadillo repeat containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKARYT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARMC4 (NP_060546, 945 a.a. ~ 1044 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 55130
Clone Number 5F1
Iso type IgG1 Kappa

Enviar uma mensagem


ARMC4 monoclonal antibody (M02A), clone 5F1

ARMC4 monoclonal antibody (M02A), clone 5F1