ARMC4 polyclonal antibody (A01)
  • ARMC4 polyclonal antibody (A01)

ARMC4 polyclonal antibody (A01)

Ref: AB-H00055130-A01
ARMC4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARMC4.
Información adicional
Size 50 uL
Gene Name ARMC4
Gene Alias DKFZp434P1735|FLJ10376|FLJ10817|FLJ32798|RP11-691I13.1
Gene Description armadillo repeat containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKARYT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARMC4 (NP_060546, 945 a.a. ~ 1044 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55130

Enviar uma mensagem


ARMC4 polyclonal antibody (A01)

ARMC4 polyclonal antibody (A01)