C6orf166 monoclonal antibody (M01), clone 3D9
  • C6orf166 monoclonal antibody (M01), clone 3D9

C6orf166 monoclonal antibody (M01), clone 3D9

Ref: AB-H00055122-M01
C6orf166 monoclonal antibody (M01), clone 3D9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant C6orf166.
Información adicional
Size 100 ug
Gene Name AKIRIN2
Gene Alias C6orf166|FBI1|FLJ10342|dJ486L4.2
Gene Description akirin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C6orf166 (AAH00764, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55122
Clone Number 3D9
Iso type IgG2a Kappa

Enviar uma mensagem


C6orf166 monoclonal antibody (M01), clone 3D9

C6orf166 monoclonal antibody (M01), clone 3D9