FANCL purified MaxPab rabbit polyclonal antibody (D01P)
  • FANCL purified MaxPab rabbit polyclonal antibody (D01P)

FANCL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055120-D01P
FANCL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FANCL protein.
Información adicional
Size 100 ug
Gene Name FANCL
Gene Alias FAAP43|FLJ10335|PHF9|POG
Gene Description Fanconi anemia, complementation group L
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FANCL (NP_060532.2, 1 a.a. ~ 375 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55120

Enviar uma mensagem


FANCL purified MaxPab rabbit polyclonal antibody (D01P)

FANCL purified MaxPab rabbit polyclonal antibody (D01P)