CRTAC1 purified MaxPab mouse polyclonal antibody (B01P)
  • CRTAC1 purified MaxPab mouse polyclonal antibody (B01P)

CRTAC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055118-B01P
CRTAC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CRTAC1 protein.
Información adicional
Size 50 ug
Gene Name CRTAC1
Gene Alias ASPIC1|CEP-68|FLJ10320
Gene Description cartilage acidic protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CRTAC1 (AAH34245.1, 1 a.a. ~ 451 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55118

Enviar uma mensagem


CRTAC1 purified MaxPab mouse polyclonal antibody (B01P)

CRTAC1 purified MaxPab mouse polyclonal antibody (B01P)