PLEKHJ1 purified MaxPab mouse polyclonal antibody (B01P)
  • PLEKHJ1 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHJ1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055111-B01P
PLEKHJ1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLEKHJ1 protein.
Información adicional
Size 50 ug
Gene Name PLEKHJ1
Gene Alias FLJ10297|GNRPX
Gene Description pleckstrin homology domain containing, family J member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALLLERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGLQA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLEKHJ1 (NP_060519.1, 1 a.a. ~ 149 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55111

Enviar uma mensagem


PLEKHJ1 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHJ1 purified MaxPab mouse polyclonal antibody (B01P)