FLJ10292 purified MaxPab mouse polyclonal antibody (B01P)
  • FLJ10292 purified MaxPab mouse polyclonal antibody (B01P)

FLJ10292 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055110-B01P
FLJ10292 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FLJ10292 protein.
Información adicional
Size 50 ug
Gene Name MAGOHB
Gene Alias FLJ10292|MGN2|mago|magoh
Gene Description mago-nashi homolog B (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FLJ10292 (NP_060518.1, 1 a.a. ~ 148 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55110

Enviar uma mensagem


FLJ10292 purified MaxPab mouse polyclonal antibody (B01P)

FLJ10292 purified MaxPab mouse polyclonal antibody (B01P)