RALGPS2 monoclonal antibody (M03), clone 1A5
  • RALGPS2 monoclonal antibody (M03), clone 1A5

RALGPS2 monoclonal antibody (M03), clone 1A5

Ref: AB-H00055103-M03
RALGPS2 monoclonal antibody (M03), clone 1A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RALGPS2.
Información adicional
Size 100 ug
Gene Name RALGPS2
Gene Alias FLJ10244|FLJ25604|KIAA0351|dJ595C2.1
Gene Description Ral GEF with PH domain and SH3 binding motif 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq LKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RALGPS2 (NP_689876, 282 a.a. ~ 386 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55103
Clone Number 1A5
Iso type IgG2a Kappa

Enviar uma mensagem


RALGPS2 monoclonal antibody (M03), clone 1A5

RALGPS2 monoclonal antibody (M03), clone 1A5