RALGPS2 purified MaxPab rabbit polyclonal antibody (D01P)
  • RALGPS2 purified MaxPab rabbit polyclonal antibody (D01P)

RALGPS2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055103-D01P
RALGPS2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RALGPS2 protein.
Información adicional
Size 100 ug
Gene Name RALGPS2
Gene Alias FLJ10244|FLJ25604|KIAA0351|dJ595C2.1
Gene Description Ral GEF with PH domain and SH3 binding motif 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPMLPH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RALGPS2 (NP_060507.1, 1 a.a. ~ 279 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55103

Enviar uma mensagem


RALGPS2 purified MaxPab rabbit polyclonal antibody (D01P)

RALGPS2 purified MaxPab rabbit polyclonal antibody (D01P)