UACA purified MaxPab mouse polyclonal antibody (B03P)
  • UACA purified MaxPab mouse polyclonal antibody (B03P)

UACA purified MaxPab mouse polyclonal antibody (B03P)

Ref: AB-H00055075-B03P
UACA purified MaxPab mouse polyclonal antibody (B03P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UACA protein.
Información adicional
Size 50 ug
Gene Name UACA
Gene Alias FLJ10128|KIAA1561|MGC141967|MGC141969|NUCLING
Gene Description uveal autoantigen with coiled-coil domains and ankyrin repeats
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKVTSILAKKGVNPGKLDVEGRSVFHVVTSKGNLECLNAILIHGVDITTSDTAGRNALHLAAKYGHALCLQKLLQYNCPTEHADLQGRTALHDAAMADCPSSIQLLCDHGASVNAKDVDGRTPLVLATQMSRPTICQLLIDRGADVNSRDKQNRTALMLGCEYGCRDAVEVLIKNGADISLLDALGHDSSYYARIGDNLDILTLLKTA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UACA (NP_060473.2, 1 a.a. ~ 1416 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55075

Enviar uma mensagem


UACA purified MaxPab mouse polyclonal antibody (B03P)

UACA purified MaxPab mouse polyclonal antibody (B03P)