GPR172B purified MaxPab mouse polyclonal antibody (B01P)
  • GPR172B purified MaxPab mouse polyclonal antibody (B01P)

GPR172B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055065-B01P
GPR172B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GPR172B protein.
Información adicional
Size 50 ug
Gene Name GPR172B
Gene Alias FLJ10060|GPCR|GPCR42|PAR2|RFT1
Gene Description G protein-coupled receptor 172B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GPR172B (NP_060456.2, 1 a.a. ~ 448 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55065

Enviar uma mensagem


GPR172B purified MaxPab mouse polyclonal antibody (B01P)

GPR172B purified MaxPab mouse polyclonal antibody (B01P)