View larger
Mouse polyclonal antibody raised against a full-length human PLEKHB2 protein.
AB-H00055041-B01P
New product
PLEKHB2 MaxPab mouse polyclonal antibody (B01P)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | PLEKHB2 |
| Gene Alias | EVT2|FLJ20783|FLJ23679|FLJ30436 |
| Gene Description | pleckstrin homology domain containing, family B (evectins) member 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEELHSKGPKIHTTTSAKTQAVLPTRCFFPSESPIRRSVQISVLLPAVNIRRRIKLTFPQPARPRAPRSLCLWQTWFAGKRAPSLPTAATAPALPSCPSPPAPSKALPPSLAGWRS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | PLEKHB2 (NP_001026876, 1 a.a. ~ 309 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 55041 |
More info
Mouse polyclonal antibody raised against a full-length human PLEKHB2 protein.