EPN3 polyclonal antibody (A01)
  • EPN3 polyclonal antibody (A01)

EPN3 polyclonal antibody (A01)

Ref: AB-H00055040-A01
EPN3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EPN3.
Información adicional
Size 50 uL
Gene Name EPN3
Gene Alias FLJ20778|MGC129899
Gene Description epsin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PGFRPNTEASGSSWGPSADPWSPIPSGTVLSRSQPWDLTPMLSSSEPWGRTPVLPAGPPTTDPWALNSPHYKLPSTGADPWGASLETSDTPGGASTFDPFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPN3 (NP_060427, 326 a.a. ~ 426 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55040

Enviar uma mensagem


EPN3 polyclonal antibody (A01)

EPN3 polyclonal antibody (A01)