TRMT12 purified MaxPab mouse polyclonal antibody (B01P)
  • TRMT12 purified MaxPab mouse polyclonal antibody (B01P)

TRMT12 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055039-B01P
TRMT12 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRMT12 protein.
Información adicional
Size 50 ug
Gene Name TRMT12
Gene Alias FLJ20772|TRM12|TYW2
Gene Description tRNA methyltransferase 12 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRENVVVSNMERESGKPVAVVAVVTEPRFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVEGRGVKWSAELEADLPRSWQRHGNLLLLSEDCFQAKQWKNLGPELWETVALALGVQRLAKRGRVSPDGTRTPAVTLLLGDHGWVEHVDNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPFLVH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRMT12 (AAH11713.1, 1 a.a. ~ 448 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55039

Enviar uma mensagem


TRMT12 purified MaxPab mouse polyclonal antibody (B01P)

TRMT12 purified MaxPab mouse polyclonal antibody (B01P)