PTCD3 purified MaxPab rabbit polyclonal antibody (D01P)
  • PTCD3 purified MaxPab rabbit polyclonal antibody (D01P)

PTCD3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00055037-D01P
PTCD3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PTCD3 protein.
Información adicional
Size 100 ug
Gene Name PTCD3
Gene Alias DKFZp666K071|FLJ20758
Gene Description Pentatricopeptide repeat domain 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAVVSAVRWLGLRSRLGQPLTGRRAGLCEQARSCRFYSGSATLSKVEGTDVTGIEEVVIPKKKTWDKVAVLQALASTVNRDTTAVPYVFQDDPYLMPASSLESRSFLLAKKSGENVAKFIINSYPKYFQKDIAEPHIPCLMPEYFEPQIKDISEAALKERIELRKVKASVDMFDQLLQAGTTVSLETTNSLLDLLCYYGDQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTCD3 (NP_060422.4, 1 a.a. ~ 689 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55037

Enviar uma mensagem


PTCD3 purified MaxPab rabbit polyclonal antibody (D01P)

PTCD3 purified MaxPab rabbit polyclonal antibody (D01P)