FBXO34 polyclonal antibody (A01)
  • FBXO34 polyclonal antibody (A01)

FBXO34 polyclonal antibody (A01)

Ref: AB-H00055030-A01
FBXO34 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXO34.
Información adicional
Size 50 uL
Gene Name FBXO34
Gene Alias CGI-301|DKFZp547C162|FLJ20725|Fbx34|MGC126434|MGC126435
Gene Description F-box protein 34
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MHLKPYWKLQKKEHPPEVSRETQRTPMNHQKAVNDETCKASHITSSVFPSASLGKASSRKPFGILSPNVLCSMSGKSPVESSLNVKTKKNAPSATIHQGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO34 (NP_060413, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55030

Enviar uma mensagem


FBXO34 polyclonal antibody (A01)

FBXO34 polyclonal antibody (A01)