ULK4 purified MaxPab rabbit polyclonal antibody (D01P)
  • ULK4 purified MaxPab rabbit polyclonal antibody (D01P)

ULK4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054986-D01P
ULK4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ULK4 protein.
Información adicional
Size 100 ug
Gene Name ULK4
Gene Alias DKFZp434E1822|FAM7C1|FLJ20574|REC01035
Gene Description unc-51-like kinase 4 (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MENFILYEEIGRGSKTVVYKGRRKGTINFVAILCTDKCKRPEITNWVRLTREIKHKNIVTFHEWYETSNHLWLVVELCTGGSLKTVIAQDENLPEDVVREFGIDLISGLHHLHKLGILFCDISPRKILLEGPGTLKFSNFCLAKVEGENLEEFFALVAAEEGGGDNGENVLKKSMKSRVKGSPVYTAPEVVRGADFSISSDLWSLGCLLYEMFSGKPPFFSESISELTEKILCEDPLPPIPKDSSRPKASSDFIN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ULK4 (ENSP00000307581, 1 a.a. ~ 580 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54986

Enviar uma mensagem


ULK4 purified MaxPab rabbit polyclonal antibody (D01P)

ULK4 purified MaxPab rabbit polyclonal antibody (D01P)