C9orf95 purified MaxPab rabbit polyclonal antibody (D01P)
  • C9orf95 purified MaxPab rabbit polyclonal antibody (D01P)

C9orf95 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00054981-D01P
C9orf95 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C9orf95 protein.
Información adicional
Size 100 ug
Gene Name C9orf95
Gene Alias FLJ20559|NRK1|RP11-235O14.2|bA235O14.2
Gene Description chromosome 9 open reading frame 95
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C9orf95 (NP_060351.1, 1 a.a. ~ 199 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54981

Enviar uma mensagem


C9orf95 purified MaxPab rabbit polyclonal antibody (D01P)

C9orf95 purified MaxPab rabbit polyclonal antibody (D01P)