C20orf27 purified MaxPab mouse polyclonal antibody (B01P)
  • C20orf27 purified MaxPab mouse polyclonal antibody (B01P)

C20orf27 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054976-B01P
C20orf27 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C20orf27 protein.
Información adicional
Size 50 ug
Gene Name C20orf27
Gene Alias FLJ20550
Gene Description chromosome 20 open reading frame 27
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAANKGNKPRVRSIRFAAGHDAEGSHSHVHFDEKLHDSVVMVTQESDSSFLVKVGFLKILHRYEITFTLPPVHRLSKDVREAPVPSLHLKLLSVVPVPEGYSVKCEYSAHKEGVLKEEILLACEGGTGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEHSDWHGFD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C20orf27 (AAH12196.1, 1 a.a. ~ 174 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54976

Enviar uma mensagem


C20orf27 purified MaxPab mouse polyclonal antibody (B01P)

C20orf27 purified MaxPab mouse polyclonal antibody (B01P)