View larger
Mouse monoclonal antibody raised against a full-length recombinant THG1L.
AB-H00054974-M01
New product
THG1L monoclonal antibody (M01), clone 4F11
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | THG1L |
| Gene Alias | FLJ11601|FLJ20546|ICF45 |
| Gene Description | tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,S-ELISA,ELISA |
| Immunogen Prot. Seq | MAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGD |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | THG1L (AAH01523, 1 a.a. ~ 269 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 54974 |
| Clone Number | 4F11 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a full-length recombinant THG1L.