CXorf48 purified MaxPab mouse polyclonal antibody (B01P)
  • CXorf48 purified MaxPab mouse polyclonal antibody (B01P)

CXorf48 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00054967-B01P
CXorf48 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CXorf48 protein.
Información adicional
Size 50 ug
Gene Name CXorf48
Gene Alias FLJ20527
Gene Description chromosome X open reading frame 48
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEVCITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVHKSSSGFQDDGGLGRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CXorf48 (NP_001026875, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54967

Enviar uma mensagem


CXorf48 purified MaxPab mouse polyclonal antibody (B01P)

CXorf48 purified MaxPab mouse polyclonal antibody (B01P)